<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6392 CA15887 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 12
2 AZT+DDI 65
3 AZT 34
4 3TC+AZT 13
5 D4T+DDC+IDV 17
6 3TC+AZT+IDV 13
7 RTV+SQV 17
8 3TC+AZT+DDC+NFV 39
9 D4T+DDI+NVP 47
10 ABC+D4T+EFV 63

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184MI, L210W, T215Y K219R K103N, V106A F227L M16V, K20R, T39A, E44D, R83K, V118I, K122P, S162C, I178L, G196E, E203K, H208Y, R211D, K223E, E224D, A272P, K277R, T286A, E297KR, A304G  
>CA15887| codons 1-304
PISPIETVPVKLKPGVDGPRVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSATVLDVGDAYFSIPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLVI
YQYIDDLYVGSDLEIEQHRTKIKELRQYLWDWGFYTPDRKHQEDPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
LELG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82VA   L10LI, M36I, I62V, L63P, A71V, V75VI  
>CA16151| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVIGTILVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005