<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6373 CA15866 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 157
2 DDI 48
3 AZT+DDI+NVP 122
4 AZT+DDI+EFV 41

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215Y K219Q K103N, G190A   I135T, T200A, Q207E, V245E, A272P K259KT, N265NS
>CA15866| codons 1-280
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEIGQHRAKIEELREHLLRWGFYTPDQKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQTLVGKLSWASQIYPGIKVKQLC

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  T74TP T12A, Q18QE, L19I, M36I, N37S, L63P  
>CA16129| codons 10-99
LVAIKIGGEIKEALLDTGADDTVLEEISLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGH
KAIGPVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005