<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1410 CA15863 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+DDC+DLV+NFV 26
2 D4T+DLV+NFV 24
3 3TC+D4T+IDV+NFV 97

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74LI K219Q Y181YC   K20R, V35M, T39TA, K43KE, K101KQ, K103R, S162A, G196E, Q207QE, F214L, T215X, L228H, A272P, K277R, A288T, I293V  
>CA15863| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICAELEEEGKISKIGPENPYNTPV
FAIKKKNSDRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLQKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRTKIEELREHLLRWGLXTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKTLTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L10FI, G73T N37H, I62V, L63P, I72IL, V77I, I93IL  
>CA16125| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMHLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKALTTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005