<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RW0546 RW0546 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L     V179D T39S, I142T, S162SC, K166R, D177K, T200A, L210F, R211K  
>RW0546| codons 38-247
CSELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSP
AIFQCSMTRILEPFRKQNPKIDIYQYMDDLYVGSDLEIGQHRAKIEELRQHLFKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, R41K, K55R, D60E, L63P  
>RW0546| codons 4-99
TLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIRVRQYEQIP
IEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Parker, MM Prevalence of drug-resistant and nonsubtype B HIV strains in antiretroviral-naive, HIV-infected individuals in New York State. AIDS Patient Care STDS, 2007