<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat21 Pat21 Russia 2006 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 D4T|DDI|NVP NA
2 3TC+IDV+NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90LM   I13V, K20I, E35D, M36I, R41K, H69K, V82I, I85IV, L89M  
>Pat21| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIVGRNMMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y     A98AG V35T, K43KQ, K49KR, V60I, S68SG, K102Q, K104R, K122E, D123S, I135T, K173R, Q174K, D177E, I178L, T200A, Q207E, R211K, V245Q, E248D, D250E, A272P, V276I, L283I, T286A, E291D, I293V, E297EK  
>Pat21| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEQEGKISRIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKQKRSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRKNPELVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLIRGAKALTDVVPLTKEAE
L

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010