<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat20 Pat20 Russia 2006 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 EFV+IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K20I, E35D, M36I, R41K, H69K, V82I, L89M  
>Pat20| codons 1-98
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V21D, V35I, V60I, K122E, D123S, I135T, K173R, Q174K, I178M, G196E, T200A, Q207E, R211K, V245Q, E248D, A272P, K275R, V276I, L283I, E291D, V292I, I293V, E297A, V317A, D324E, I329V K22Q
>Pat20| codons 1-333
PISPIETVPVKLKPGMDGPKDQQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRKNPDMVI
YQYMDDLYVGSDLEIEQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIRIKQLCKLIRGTKALTDIVPLTAEAE
LELAENREILKEPVHGAYYDPSKELIAEVQKQG

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010