<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat19 Pat19 Russia 2006 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 EFV NA
2 3TC+DDI+LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82M V11VI, F53L L10V, T12S, I13V, I15IV, L19P, K20I, E35DN, M36I, R41K, K45V, Q61QH, I64V, C67CY, G68D, H69K, A71V, L89I  
>Pat19| codons 1-99
PQITLWQRPVISVKVGGQPIEALLDTGADDTVLENINLPGKWKPVIIGGVGGLVKVRQYD
HILVEIYDKKVIGTVLVGPTPMNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F V75M, K219Q Y181C, G190A   P4Q, K20R, V21I, V35I, T39A, V60I, K101KQ, K102Q, D121H, K122E, D123S, K166R, Q174R, D177E, I178M, T200A, Q207E, H208Y, R211K, D218E, L228H, V245Q, E248D, D250E, A272P, L283I, T286A, E291D, V292I, I293V, E297AT, R307RK, I329V V179Q
>Pat19| codons 1-333
PISQIETVPVKLKPGMDGPRIKQWPLTEEKIKALIEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLQQKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKRNPEMQI
CQYVDDLYVASDLEIGQHRAKIEELREYLLKWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGAKALTDIVPLTTEAE
LELAENKEILKEPVHGVYYDPSKDLIAEVQKQG

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010