<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat18 Pat18 Russia 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC+IDV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  K219Q     V35T, V60I, T69S, K122E, D123S, I135T, K173T, Q174N, D177E, I178M, T200E, E203K, Q207E, R211K, V245Q, E248D, D250E, A272P, V276I, L283I, E291D, V292I, I293V, E297A, D324E, I329V  
>Pat18| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTNNPEMVI
YQYMDDLYVGSDLEIGQHREKIKELREHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLIRGTKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T4S, I13V, K20I, E35D, M36I, R41K, K43R, C67Y, H69K, V82I, L89M  
>Pat18| codons 1-99
PQISLWQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVRQYD
QILIEIYGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010