<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat17 Pat17 Russia 2006 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 EFV|SQV NA
2 DDI+LPV+NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M L33I, L89V L10V, I13A, K20V, A22V, E35D, M36I, N37E, R41K, R57K, I62V, L63LP, H69K, K70R, A71T, T74S  
>Pat17| codons 1-99
PQITLWQRPVVTAKIGGQLVEVLLDTGADDTVIEDIELPGKWKPKIIGGIGGFVKVKQYD
QVPIEICGKRTIGSVLVGPTPANIIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N T215C, K219Q K103N V108I, V179E K32I, V35R, T39A, V60I, T69N, K102Q, K122E, D123S, I132L, K173R, Q174K, D177E, I178M, E194EA, I195L, G196E, Q197I, T200A, E203D, Q207E, L228H, V245Q, E248D, D250E, A272P, L283I, T286P, E291D, V292I, I293V, E297EK E302A
>Pat17| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALREICAELEKEGKISKIGPENPYNTPI
FAIKKKNSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQNKSVTILDVGDAYFSVPL
DESFRKYTAFTLPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRKNPEMEI
YQYMDDLYVGSDLALEIHRAKIDELREHLLRWGFCTPDQKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGPKALTDIVPLTKEAE
LAL

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010