<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat16 Pat16 Russia 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT NA
2 EFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T4S, I13V, K14KR, K20I, M36I, N37D, R41K, K43R, I64M, C67Y, H69K, V82I, L89M R87RG
>Pat16| codons 1-99
PQISLWQRPLVTVRIGGQLIEALLDTGADDTVLEEIDLPGKWRPKMIGGIGGFIKVRQYD
QILMEIYGKKAIGTVLVGPTPINIIGGNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML T215TADN     V35T, V60I, T69TS, K102Q, K104KR, K122E, D123S, I135V, K173T, Q174N, D177E, I178IM, T200A, Q207E, R211K, V245Q, E248D, D250DE, A272P, V276I, L283I, R284RK, T286TN, V292VI, I293V, E297A, V317A, D324E  
>Pat16| codons 1-325
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKRSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTNNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFNTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLIKGNKALTEIVPLTAEAE
LELAENREILKEPVHGAYYDPSKEL

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010