<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat14 Pat14 Russia 2006 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 EFV|NVP|SQV NA
2 3TC+DDI+LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82S, L90M K43T L10I, T12K, I13V, I15V, K20I, E35N, M36I, N37D, R41K, Q61HN, L63C, C67W, H69K, T74S, L89I  
>Pat14| codons 1-99
PQITLWQRPIVKVKVGGQLIEALLDTGADDTVLENIDLPGKWTPKLIVGIGGFVKVRQYD
NICIEIWGKKAIGSVLVGPTPSNIIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LV, L210W, T215Y K219KE K101E, Y181C, G190A   V35T, T39TA, V60I, K102Q, K104KR, V118VI, K122E, D123S, I135T, K173N, Q174K, D177E, I178M, I195IM, T200A, E203EK, Q207D, R211K, D218DE, V245Q, E248D, D250E, A272P, L283I, V292I, I293IV, E297A, D324E, I329V P1PA, E138T, S191SCW
>Pat14| codons 1-333
AISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEQKRSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSTNNTTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRNKNPEMVI
CQYMDDLYVAWDLEMGQHRAKIKELRDHLWKWGFYTPEEKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEIVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAEVQKQG

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010