<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat13 Pat13 Russia 2006 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 DDI|NFV NA
2 3TC+AZT+IDV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N T215L, K219Q K103N   K32I, V35R, V60I, T69N, K102Q, K104R, K122E, D123S, I135T, I142IT, S162C, Q174N, D177E, I178M, I195L, T200A, I202V, Q207D, R211K, V245Q, E248D, D250E, S251SN, A272P, L283I, I293V, P294T, E297A, V317A, D324E, I329V  
>Pat13| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIIALREICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQNRSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKNNPEMVI
YQYMDDLYVGSDLELGQHRAKVEELRDHLLKWGFLTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKENWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVVTLTAEAE
LELAENREILKEPVHGAYYDPSKELIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, E35D, M36I, R41K, K43R, H69K, V82I, L89M  
>Pat13| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010