<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat12 Pat12 Russia 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K20I, E35D, M36I, N37NI, R41K, I66IV, H69K, V82I, L89I  
>Pat12| codons 1-98
PQITLWQRPIVTVKIGGQLIEALLDTGADDTVLEDIILPGKWKPKMIGGIGGFIKVRQYD
QILIEVCGKKAIGTVLVGPTPINIIGRNILTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     V35T, V60I, R83RK, K104R, K122E, D123S, K173R, Q174R, D177E, I178M, T200A, Q207E, R211K, F214L, K238R, V245Q, E248D, D250E, A272P, V276I, K277R, L283I, T286A, V292I, I293V, E297A, V317A, D324E, I329V  
>Pat12| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRRNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDQKHQKEPPFLWMGYELHPDRWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKIRQLCKLIRGAKALTEIVPLTAEAE
LELAENREILKEPVHGAYYDPSKELIAEVQKQG

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010