<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat11 Pat11 Russia 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 EFV NA
2 3TC+IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54V L33I, N88D, L89V I13V, L19P, K20I, E35N, M36I, N37D, R41K, K43R, K45Q, H69K, T74S, V82I  
>Pat11| codons 1-99
PQITLWQRPLVTVKIGGQPIEALLDTGADNTVIENIDLPGKWRPQMIGGIGGFVKVRQYD
QILIEICGKKAIGSVLVGPTPINIIGRDVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V K219KQ Y181YC P225PH V21I, V35T, K49R, V60I, K102Q, K104R, K122E, D123G, K166R, K173T, Q174R, D177E, I178M, T200A, Q207E, R211K, H221HY, V245Q, E248D, D250E, A272P, V276VA, K277R, L283I, I293V, E297A, V317A, D324E, I329V  
>Pat11| codons 1-333
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKRSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRTRNPEMVI
CQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDQKYQKEHPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKARQLCKLIRGTKALTEVVPLTAEAE
LELAENREILKEPVHGAYYDPSKELIAEVQKQG

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010