<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat10 Pat10 Russia 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC|NVP NA
2 D4T+DDI+NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14KR, K20I, E35D, M36I, N37D, R41K, H69K, K70R, V82I, L89M  
>Pat10| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MIV K219KE Y181YC   V21VI, V35VAIT, K49R, I50IV, V60VI, K102Q, K104R, K122E, D123S, I135IM, K173T, Q174K, D177E, I178M, I195IL, T200A, E203EG, Q207E, R211K, D218DE, D237DN, V245Q, E248D, D250E, A272P, V276I, L283I, V292VI, I293V, P294PA, E297A, V317A, D324E, I329V S48I
>Pat10| codons 1-333
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICTEMEKEGKIIRVGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKRSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEMVI
CQYVDDLYVGSDLELGQHRAKIGELREHLLKWGFTTPEEKHQKEPPFLWMGYELHPNKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLIRGTKALTEIVALTAEAE
LELAENREILKEPVHGAYYDPSKELIAEVQKQG

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010