<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat09 Pat09 Russia 2006 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC NA
2 D4T+DDI+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215F   K103N, Y188L   L34I, V35T, K102Q, V118I, K122E, D123S, G141A, K166R, K173R, D177E, I178M, T200A, Q207E, R211K, F214L, V245Q, E248D, D250E, A272P, V276I, L283I, E291D, I293V, E297EK E302A
>Pat09| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKAITEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQNKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSINNETPAIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRRQNPEMVI
YQYMDDLLVGSDLEIGQHRAKIEELREHLLKWGLFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLIRGTKALTDVVPLTKEAE
LAL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V32VA I13V, I15V, K20V, E35D, M36I, R41K, R57K, H69K, T74S, V82I, L89M  
>Pat09| codons 1-99
PQITLWQRPLVTVKVGGQLVEALLDTGADDTALEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGSVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010