<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat08 Pat08 Russia 2006 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC|AZT|EFV|IDV|NFV NA
2 D4T+DDI+LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54A, V82M, L90M K43T T4A, L10I, I13V, I15V, L19P, K20I, M36I, N37E, R41K, V56A, R57K, L63P, H69K, A71V, T74S, V77I, L89I, Q92K E35S
>Pat08| codons 1-99
PQIALWQRPIVTVKVGGQPIEALLDTGADDTVLESIELPGKWTPKIIGGIGGFAKAKQYD
QIPIEICGKKVIGSVLIGPTPMNIIGRNIMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74LI, T215F K219EQ K101E, Y181C, G190A V108I, Y318F K20R, V35I, T39A, K49KR, V60I, K102Q, V118VI, K122E, D123N, I135K, S162D, K173R, I178M, T200A, E204EQ, Q207DE, R211K, D218E, L228H, V245Q, E248ED, D250E, S251G, A272P, L283I, V292I, I293V, E297A, V317A, I329IV  
>Pat08| codons 1-333
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICAELEKEGKISRIGPENPYNTPI
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLEQKKSVTILDVGDAYFSIPL
DENFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRRQNPDMVI
CQYMDDLYVASDLEIGQHRAKIEQLREHLLKWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKEGWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEIVPLTAEAE
LELAENREILKEPVHGAFYDPSKDLIAEVQKQG

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010