<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat07 Pat07 Russia 2006 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 EFV NA
2 3TC+D4T+LPV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215F D67DG   V179E V21I, V35T, V60VI, S68SG, K104R, K122E, D123S, I135T, I142V, Q174K, D177E, I178M, T200A, Q207A, R211K, V245Q, E248D, D250E, A272P, V276I, I293V, E297A, V317A, P321S, D324E, I329V, Q332H L283IT
>Pat07| codons 1-333
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKGGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPEMEI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLTRGTKALTEVVPLTAEAE
LELAENREILKEPVHGAYYDSSKELIAEVQKHG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82M Q58E L10V, I13A, K20IM, A22AV, E35D, M36I, R41RK, I62IV, L63P, H69K, L89I, T91S  
>Pat07| codons 1-98
PQITLWQRPVVTAKIGGQLMEVLLDTGADDTVLEDINLPGKWKPKIIGGIGGFVKVREYD
QVPIEICGKKAIGTVVVGPTPMNIIGRNILSQIGCTLN

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010