<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat06 Pat06 Russia 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 DDI+NFV+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, T215F   K103N   V35I, K64R, A98S, K102Q, K122E, D123NS, I135L, K173R, Q174K, I178M, T200A, R211K, V245Q, E248D, D250E, A272P, L283I, E291D, V292I, I293V, V317A, S322A, D324E, I329V  
>Pat06| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIRKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLKQNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRKNPDMVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTDIVPLTEEAE
LELAENREILKEPVHGAYYDPAKELIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L89V I13V, I15V, K20T, E35D, M36I, N37DE, R41K, R57K, I62V, H69K, A71AT, T74S, V82I  
>Pat06| codons 1-99
PQITLWQRPLVTVKVGGQLTEALLDTGADDTVLEDIELPGKWKPKMIGGIGGFIKVKQYD
QVLIEICGKKTIGSVLVGPTPINIIGRNVMTQIGCTLNF

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010