<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat05 Pat05 Russia 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 DDI+EFV+NFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, T215F K219Q K101P, K103N   I2IV, V60I, T69N, V90I, I94IL, K102Q, V106VI, K122E, D123S, I135T, S162Y, K173S, Q174K, D177E, I178IL, I195L, T200A, E203ED, Q207E, R211K, V245Q, E248D, D250E, A272P, V276I, L283I, A288AT, V292VI, I293V, E297A, V317A, D324E, I329IV  
>Pat05| codons 1-333
PVSPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKIVDFRELNKRTQDFWEIQLGLPHPAGLPQNKSITVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRSKNPELVI
YQYMDDLYVGSDLELGQHRAKIDELREHLLKWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLIRGTKTLTEIVPLTAEAE
LELAENREILKEPVHGAYYDPSKELIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, I15IV, L19LI, E35DG, M36I, N37ND, R41K, I62IV, L63LP, H69K, K70KR, A71T, T74TS, V82I, L89I K20AITV
>Pat05| codons 1-99
PQITLWQRPLVTVKVGGQIVEALLDTGADDTVLEGIDLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGKRTIGSVLVGPTPINIIGRNIMTQIGCTLNF

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010