<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat04 Pat04 Russia 2006 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35I, V60I, K102Q, K104R, K122E, D123N, I135L, I142V, K173R, Q174K, P176S, D177E, I178M, T200A, Q207E, V245Q, E248D, D250E, A272P, L283LI, V292I, I293V, E297EK P119PL, E302A
>Pat04| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKRSVTVLDVGDAYFSVLL
DENFRKYTAFTIPSLNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRKNSEMVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEIVPLTKEAE
LAL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N Q58E, N88D I13V, K20I, E35N, M36I, R41K, K45R, H69K, K70R, V82I, L89M  
>Pat04| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADNTVLENINLPGKWKPRMIGGIGGFIKVREYD
QILIEICGKRAIGTVLVGPTPINIIGRDMLTQIGCTLNF

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010