<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pat02 Pat02 Russia 2006 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K20R, V35R, V60I, K102Q, K104KR, K122E, D123S, I135T, Q174K, D177E, I178M, T200A, Q207E, R211K, F214L, K238KR, V245Q, E248D, D250E, A272P, V276I, L283I, V292I, I293V, E297A, V317A, D324E, I329V E6*KQ, E203EGKR
>Pat02| codons 1-333
PISPIQTVPVKLKPGMDGPRVKQWPLTEEKIKALREICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKRSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIRELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLIRGTKALTEIVPLTAEAE
LELAENREILKEPVHGAYYDPSKELIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, K20V, E35D, M36I, N37D, R41K, H69K, T74S, V82I, L89I G40GE
>Pat02| codons 1-99
PQITLWQRPLVTVKIGGQLVEALLDTGADDTVLEDIDLPEKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGSVLVGPTPINIIGRNIMTQIGCTLNF

References
Author Title Citation
Knops, E Evolution of protease inhibitor resistance in the gag and pol genes of HIV subtype G isolates. J Antimicrob Chemother, 2010