<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4315 CA15849 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 35
2 3TC+D4T+IDV+NVP 4
3 3TC+D4T+IDV 143
4 D4T+EFV+RTV+SQV 36

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, T215F K219Q K101P, K103N   K49R, V60I, V118I, K122E, I135T, I202V, F214L, L228H, K277R, I293V, E297A  
>CA15849| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISRIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQHLLRWGLFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTAEAE
LELA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10I, K20I, E35D, M36I, R41K, D60E, L63P, I64V, V77I  
>CA16110| codons 1-99
PQITLWQRPIVTIKIGGQLIEALIDTGADDTVLEDINLPGKWKPKLIGGIGGFVKVRQYE
QIPVEICGHKAIGTVLIGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005