<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
O921 O921 Vietnam 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, I13V, K14R, Q18H, E35D, M36I, R41K, H69K, V82I, L89M  
>O921| codons 1-99
PQITLWQRPLVPVRIGGHLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V35I, V111I, K122E, D123S, S162G, K173I, Q174K, D177E, Q207S, R211S, F214L  
>O921| codons 1-220
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQGSMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRSHLLSWGLTTPDKK

References
Author Title Citation
Phan, TT Characterization of HIV type 1 genotypes and drug resistance mutations among drug-naive HIV type 1-infected patients in northern Vietnam. ARHR, 2010