<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1422 CA15819 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 29
2 None 14
3 AZT 2
4 None 7
5 DDI 23
6 None 3
7 DDI 4
8 AZT+DDC 6
9 DDC 8
10 None 9
11 DDI 8
12 None 21
13 D4T 4
14 None 23
15 D4T 15
16 3TC+D4T 37
17 3TC+NVP 4
18 3TC+D4T 40
19 DDC+NFV+SQV 27
20 EFV+NFV+SQV 8
21 EFV+NFV 6
22 D4T+EFV+NFV 46
23 D4T+NFV+SQV 12
24 APV+D4T+SQV 10
25 ABC+D4T+NVP 11
26 3TC+ABC+D4T+NVP 3

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR   G190S   E6K, M16MV, V35M, K122E, K166R, T200IM, V245E, A272P, K277R, I293V  
>CA15819| codons 1-300
PISPIKTVPVKLKPGVDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVSSDLEIGQHRIKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q18QE, L63P  
>CA16080| codons 1-99
PQITLWQRPLVTIKIGGELKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005