<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
K327 K327 Korea 2008 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G16E, K20I, M36I, N37D, R41K, K43R, H69K, K70R, L89M  
>K327| codons 1-99
PQITLWQRPLVTVRIEGQLIEALLDTGADDTVLEEIDLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, P14E, V35T, E36D, E40D, D121Y, K122E, S162A, K173T, Q174K, D177E, Q197L, T200A, Q207A, R211K, V245Q, E248D, T286A, A288S, E291D, V292I, I293V, P294T, S322T P4N
>K327| codons 1-335
PISNIDTVPVKLKEGMDGPKVKQWPLTEEKIKALTDICTDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIGLHRAKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKSLTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQG

References
Author Title Citation
Chin, BS Comparison of genotypic resistance mutations in treatment-naive HIV type 1-infected patients in Korea and China. ARHR, 2010