<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
K056 K056 Korea 2008 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15IMV, G16GE, K20KR, E34EA, M36MI, N37X, P39PS, R41K, H69K, L89M  
>K056| codons 1-99
PQITLWQRPVVTIKVEGQLREALLDTGADDTVLAEIXLSGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D K20R, V35T, E36A, T39E, S48T, V60I, K122E, D123S, I135R, K173T, Q174K, N175NY, D177E, T200A, I202V, Q207A, R211K, F214L, V245Q  
>K056| codons 1-246
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKYPEIDI
YQYMDDLYVGSDLEIGQHRAKVEELRAHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQL

References
Author Title Citation
Chin, BS Comparison of genotypic resistance mutations in treatment-naive HIV type 1-infected patients in Korea and China. ARHR, 2010