<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5147 CA15810 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 87
2 DDC 114
3 AZT+ DDC+ 3TC 50
4 IDV+ AZT+ 3TC 139
5 DDI+ D4T+ SQV+ NFV 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184MV, L210W, T215Y K219R     K43S, E44D, E53D, V118I, K122E, S162Y, Q174E, Q197L, E203EK, R211K, K223Q, L228R, A272P, T286A  
>CA15810| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELESDGKISKIGPDNPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKENPDIVI
YQYVDDLYVGSDLEIGLHRTKIKELRQHLWKWGFYTPDRKHQQEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I64V, I72M  
>CA14967| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAMGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005