<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
C182 C182 China 2005 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, E35D, M36I, R41K, L63T, H69K, L89M, L97I  
>C182| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTINF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, K20R, V35T, T39K, K43E, V60VI, W88S, D121H, K122E, D123S, K173I, Q174K, D177E, I178V, Q207A, R211S, F214L, K238R, V245E  
>C182| codons 1-254
PISPIDTVPVTLKPGMDGPRVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFSEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEVVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTV

References
Author Title Citation
Chin, BS Comparison of genotypic resistance mutations in treatment-naive HIV type 1-infected patients in Korea and China. ARHR, 2010