<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Dag11 Dag11 Russia 2006 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, L63S, I64M, H69K, V77I, L89M, I93L  
>Dag11| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QISMEICGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, V35T, E36D, T39R, K122E, D123S, A158S, K173L, Q174K, D177E, Q197QR, Q207A, R211S, V245M, E248D, A272P, K277R, T286A, E291D, V292I, I293V, I326V  
>Dag11| codons 1-330
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTDICREMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVGSDLEIGRHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQ

References
Author Title Citation
Vinogradova, A Short communication: Molecular epidemiology of HIV type 1 in the Republic of Dagestan, Russian Federation: Virtually uniform circulation of subtype A, former Soviet Union variant, with predominance of the V77I(PR) subvariant. ARHR, 2010