<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
10 Virus109 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|RAL|RTI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
G140GS, Q148K H51HY S24SG, L101I, T112I, K211Q, I217V  
>Virus109| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMAGDFNLPPVVAKEIVASCDKCQLKGEAMYGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKIIHTDNGSN
FTSTTVKAACWWAGIKQEFSIPYNPQSKGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTQELQKQVTKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Hatano, H Evolution of integrase resistance during failure of integrase inhibitor-based antiretroviral therapy. JAIDS, 2010