<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|RAL|RTI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
Y143YC T97TA, S230SR R20K, T112V, I113V, T125A, H171Q, I200M, I203IM  
>Virus122| codons 1-288
FLDGIDKAQEEHEKYHSNWKAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQEAAYFLLKLAGRWPVKVVHTDNGSN
FTSTAVKAACWWAGIKQEFGIPCNPQSQGVVESMNKELKKIIGQVRDQAEQLKTAVQMAV
FIHNFKRKGGIGGYSAGERMVDMIATDIQTKELQKQITKIQNFRVYYRDRRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Hatano, H Evolution of integrase resistance during failure of integrase inhibitor-based antiretroviral therapy. JAIDS, 2010
Underwood, M The activity of the integrase inhibitor dolutegravir against HIV-1 variants isolated from raltegravir-treated adults. JAIDS, 2012