<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
8 Virus34 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|RAL|RTI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
E138EA, G140GS, Q148QH   S17N, I72IV, L101I, K156KN, V201I, I208L  
>Virus34| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQAFSIPYNPQSHGVVESMNNELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDLQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Hatano, H Evolution of integrase resistance during failure of integrase inhibitor-based antiretroviral therapy. JAIDS, 2010
Underwood, M The activity of the integrase inhibitor dolutegravir against HIV-1 variants isolated from raltegravir-treated adults. JAIDS, 2012