<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
8 Virus32 U.S. 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|RAL|RTI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
E138EK, G140GS, Q148QH N155ND S17N, I72V, L101LI, K156KN, V201I, I208L, D256DE D286DN
>Virus32| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQKFSIPYNPQSHGVVESMDNELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDLQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVASRQNED

References
Author Title Citation
Hatano, H Evolution of integrase resistance during failure of integrase inhibitor-based antiretroviral therapy. JAIDS, 2010
Underwood, M The activity of the integrase inhibitor dolutegravir against HIV-1 variants isolated from raltegravir-treated adults. JAIDS, 2012