<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|RTI NA
2 EVG|PI|RTI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
E92EQ Q146QL K7KR, S17N, V31I, I84IM, L101I, T112V, I135IV, G193D, V201I, T218S, D256E, D279DG  
>Virus79| codons 1-288
FLDGIDRAQEEHEKYHNNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYMEAEVIPAQTGQETAYFILKLAGRWPVKVIHTDNGSN
FTSTTVKAACWWAGVKQEFGIPYNPLSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGDYSAGERIIDIIATDIQTKELQKQISKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDGCVASRQDED

References
Author Title Citation
Hatano, H Evolution of integrase resistance during failure of integrase inhibitor-based antiretroviral therapy. JAIDS, 2010