<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2 Virus8 U.S. 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI NA
2 PI|RAL|RTI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
G140S, Q148H   L63I, I73V, L74I, E96D, L101I, T112I, I208L, D232E  
>Virus8| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQIDCTHLEGKIVIVAVHVASGYIEAEVIPAETGQDTAYFILKLAGRWPVKIIHTDNGSN
FTSTTVKAACWWAGIKQEFSIPYNPQSHGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDLQTKELQKQITKIQNFRVYYRDSREPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Hatano, H Evolution of integrase resistance during failure of integrase inhibitor-based antiretroviral therapy. JAIDS, 2010