<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1 Virus5 U.S. 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|RTI NA
2 PI|RAL|RTI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
G140S, Q148H   S17N, S24D, S39C, L45LQ, L101I, T124N, D167E, V201I, E212A R284G, D286N
>Virus5| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMADDFNLPPVVAKEIVACCDKCQQKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FTSNTVKAACWWAGIKQEFSIPYNPQSHGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKALQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASGQNED

References
Author Title Citation
Hatano, H Evolution of integrase resistance during failure of integrase inhibitor-based antiretroviral therapy. JAIDS, 2010
Underwood, M The activity of the integrase inhibitor dolutegravir against HIV-1 variants isolated from raltegravir-treated adults. JAIDS, 2012