<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1242_148 1242_148 Italy 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35M, S48E, V60I, T69S, I132IV, I135V, I178IM, E194ED, Q197E, R211K, K277R, T286A, V292I, I293IV, E297A, K311R, V317A  
>1242_148| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKIEKIGPENPYNTPI
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTVPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLDIGEHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEIVPLTAEAE
LELAENREILREPVHGAYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LI, T12I, G16E, R57K, I62IV, L63A, I72T, I93L  
>1242_148| codons 1-99
PQITLWQRPIVIIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QVAIEICGHKATGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Bonura, F Transmission of drug-resistant HIV type 1 strains in HAART-naive patients: A 5-year retrospective study in Sicily, Italy. ARHR, 2010
Tramuto, F Dynamics and molecular evolution of HIV-1 strains in Sicily among antiretroviral naive patients. Infect Genet Evol, 2013