<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1239_135 1239_135 Italy 2008 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, E40D, V60I, K104R, V118I, K122E, D123NS, I135IR, T165I, K173T, Q174K, D177E, I195T, G196E, T200A, R206RK, Q207E, F214L, L228Q, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, P294A, I329V  
>1239_135| codons 1-333
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRTKNPEIVI
YQYMDDLYVGSDLETEQHRAKIEELKEHLLRWGLTTPDKKHQKEPPFQWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVALTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, L33V, E35Q, M36I, N37D, R57K, L63P, C67E, H69K, V82I, L89M  
>1239_135| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVVEQIDLPGRWKPKMIGGIGGFIKVKQYD
QIPIEIEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Bonura, F Transmission of drug-resistant HIV type 1 strains in HAART-naive patients: A 5-year retrospective study in Sicily, Italy. ARHR, 2010
Tramuto, F Dynamics and molecular evolution of HIV-1 strains in Sicily among antiretroviral naive patients. Infect Genet Evol, 2013