<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1234_133 1234_133 Italy 2008 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12S, I15V, Q18E, L19I, K20R, E35D, M36I, R41K, R57K, L63T, E65D, I72IV, L89LM  
>1234_133| codons 1-99
PQITLWQRPVVSIKVGGEIREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIDICGHKAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39TA, V60VI, D123E, I135L, E138EG, I142IS, S162Y, K173ILST, Q174N, I195L, T200A, Q207AT, R211KQ, V245Q, E248N, A272P, K277R, T286TA, E291ED, V292I, I293V, P294T, E297A, D324DE  
>1234_133| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNGTPGSRYQYNVLPQGWKGSPAIFQYSMTKILEPFRTNNPDIVI
YQYMDDLYVGSDLELGQHRAKIEELRTHLLQWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVTLTAEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQG

References
Author Title Citation
Bonura, F Transmission of drug-resistant HIV type 1 strains in HAART-naive patients: A 5-year retrospective study in Sicily, Italy. ARHR, 2010
Tramuto, F Dynamics and molecular evolution of HIV-1 strains in Sicily among antiretroviral naive patients. Infect Genet Evol, 2013