<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1225_122 1225_122 Italy 2008 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, M36I, N37D, R41K, K43KR, L63H, H69K, K70KR, L89M  
>1225_122| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEEIDLPGKWRPKMIGGIGGFIKVRQYD
QIHIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, V60I, K102Q, K122E, I135MV, S162A, K173IT, Q174EK, D177E, I178M, T200A, Q207E, R211RK, V245VEKM, D250DE, S251SC, K277R, T286A, E291D, V292VI, I293V, S322T  
>1225_122| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKECWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQG

References
Author Title Citation
Bonura, F Transmission of drug-resistant HIV type 1 strains in HAART-naive patients: A 5-year retrospective study in Sicily, Italy. ARHR, 2010
Tramuto, F Dynamics and molecular evolution of HIV-1 strains in Sicily among antiretroviral naive patients. Infect Genet Evol, 2013