<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1170_34 1170_34 Italy 2008 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, L63P  
>1170_34| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215S     K20R, T27S, K32N, V35L, S48E, I135A, P176A, T200A, I202V, F214L, Q278E, K281KR, I293V, P294Q, E298A, K311R  
>1170_34| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLSEEKINALLEICTEMEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSANNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNADIVI
YQYMDDLYVGSDLEIGQHRAKVEELRQHLLRWGLSTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKELCRLLRGTKALTEVVQLTEAAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Bonura, F Transmission of drug-resistant HIV type 1 strains in HAART-naive patients: A 5-year retrospective study in Sicily, Italy. ARHR, 2010
Tramuto, F Dynamics and molecular evolution of HIV-1 strains in Sicily among antiretroviral naive patients. Infect Genet Evol, 2013