<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1162_26 1162_26 Italy 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I N37CS, P39PQ, R41RK, L63P, A71T, V77I  
>1162_26| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVIEEMSLQGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S48T, V90VI, K122P, I142IT, K166KR, I178L, Q197L, R211K, I244V, V245M, A272P, I293V, V317A, I329L, Q334D  
>1162_26| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGLHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPVMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAELQKQGDG

References
Author Title Citation
Bonura, F Transmission of drug-resistant HIV type 1 strains in HAART-naive patients: A 5-year retrospective study in Sicily, Italy. ARHR, 2010
Tramuto, F Dynamics and molecular evolution of HIV-1 strains in Sicily among antiretroviral naive patients. Infect Genet Evol, 2013