<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 ABC 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, L210LW V75I     S162C, T200X, E204D  
>MV-199wk16| codons 30-219
KIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLIDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAFFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRXKIEDLRQHL
WRWGFTTPDK

References
Author Title Citation
Miller, V HIV-1 reverse transcriptase (RT) genotype and susceptibility to RT inhibitors during abacavir monotherapy and combination therapy. AIDS, 2000
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005