<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
66IND449 66IND449 India 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V, T215F K219W K101E, Y181C, G190A   V35T, T39E, S48T, V60I, V118I, D121H, K122E, I135R, T139K, S162D, K173T, V179I, T200A, Q207E, H208Y, R211K, K223E, V245Q, D250E  
>66IND449| codons 8-254
VPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPIFAIKKKN
STKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPLHEDFRKY
TAFTIPSRNNEKPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRTQNPDIIICQYVDDL
YVASDLEIGQHRAKIEELREYLLKWGFFTPDWKHQEEPPFLWMGYELHPDKWTVQPIQLP
EKESWTV

References
Author Title Citation
Deshpande, A Analysis of RT sequences of subtype C HIV-type 1 isolates from Indian patients at failure of a first-line treatment according to clinical and/or immunological WHO guidelines. ARHR, 2010