<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
56IND446 56IND446 India 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, T69~ K219R V106M, Y181C   L34I, V35T, T39E, S48T, S68G, D121H, K122E, I135T, S162C, K173A, D177E, I195IM, T200A, I202V, Q207E, F214L, K223Q, V245Q P157A
>56IND446| codons 7-255
TVPVKLKPGMDGPKVKQWPLTEEKIKAITEICEEMEKEGKITKIGPENPYNTPVFAIKRK
DG~KWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPLHEDFRK
YTAFTIPSTNNETPGIRYQYNVLPQGWKGSAAIFQCSMTKILEPFRAQNPEIVICQYMDD
LYVGSDLEMGQHRAKVEELREHLLRWGLTTPDRKHQQEPPFLWMGYELHPDKWTVQPIQL
PEKDSWTVN

References
Author Title Citation
Deshpande, A Analysis of RT sequences of subtype C HIV-type 1 isolates from Indian patients at failure of a first-line treatment according to clinical and/or immunological WHO guidelines. ARHR, 2010