<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
55IND445 55IND445 India 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 1

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   Y181C   V35T, T39D, S48T, V90I, K102Q, K122E, I135M, S162Y, K166R, K173A, D177E, I178L, V179I, T200A, Q207E, L228R, V245Q L187LW
>55IND445| codons 8-254
VPVKLKPGMDGPKVKQWPLTEEKIKALTEICDEMEKEGKITKIGPENPYNTPVFAIKKKD
STKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLDEDFRKY
TAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQYSMTRILEPFRAQNPELIICQYVDDW
YVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFRWMGYELHPDKWTVQPIQLP
EKDSWTV

References
Author Title Citation
Deshpande, A Analysis of RT sequences of subtype C HIV-type 1 isolates from Indian patients at failure of a first-line treatment according to clinical and/or immunological WHO guidelines. ARHR, 2010