<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
41IND442 41IND442 India 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 208

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   K103N, Y181V V108I K20R, V35T, T39N, S48T, V60I, L109I, K122E, D123N, I135T, K173T, D177E, T200A, I202V, Q207E, R211K, H221Y, V245K W24WG
>41IND442| codons 14-255
PGMDGPRVKQGPLTEEKIKALTEICNELEKEGKITKIGPENPYNTPIFAIKKKDSTKWRK
VVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTIIDVGDAYFSVPLDENFRKYTAFTIP
STNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIVIVQYVDDLYVGSDL
EIGQHRAKVEELREHLLKWGFYTPDKKYQKEPPFLWMGYELHPDKWTVQPIKLPEKDSWT
VN

References
Author Title Citation
Deshpande, A Analysis of RT sequences of subtype C HIV-type 1 isolates from Indian patients at failure of a first-line treatment according to clinical and/or immunological WHO guidelines. ARHR, 2010