<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
37IND438 37IND438 India 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 126
2 3TC+AZT+NVP 130

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215Y V75M G190A   K20KR, V35T, T39D, S48T, V60I, T69S, K102Q, D121Y, K122E, T139R, S162AT, K173T, D177E, I178M, V179I, T200A, Q207E, R211K, V245Q  
>37IND438| codons 5-255
IETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICDELEKEGKITKIGPENPYNTPIFAIK
KKNSSRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLYEDF
RKYTAFTIPSINNERPGIRYQYNVLPQGWKGSPAIFQTSMTKILEPFRTQNPEMIIYQYV
DDLYVASDLEIGQHRAKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPI
QLPEKDSWTVN

References
Author Title Citation
Deshpande, A Analysis of RT sequences of subtype C HIV-type 1 isolates from Indian patients at failure of a first-line treatment according to clinical and/or immunological WHO guidelines. ARHR, 2010