<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
36IND437 36IND437 India 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV 74
2 3TC+AZT+NVP 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219Q K101E, V106M, G190A   E28K, K32E, V35T, E36A, T39D, S48T, V60I, V90I, I94L, D121Y, K122E, S162A, K173AT, D177E, V179VI, T200E, Q207R, R211DE, V245Q  
>36IND437| codons 8-255
VPVKLKPGMDGPKVKQWPLTKEKIEALTAICDELEKEGKITKIGPENPYNTPIFAIKKKN
STRWRKLVDFRELNKRTQDFWEIQLGLPHPAGLEKKKSMTVLDVGDAYFSVPLYEDFRKY
TAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTQNPEIIIYQYVDDL
YVASDLEIGQHREKIEELRRHLLEWGFFTPDQKHQKEPPFLWMGYELHPDKWTVQPIQLP
EKDSWTVN

References
Author Title Citation
Deshpande, A Analysis of RT sequences of subtype C HIV-type 1 isolates from Indian patients at failure of a first-line treatment according to clinical and/or immunological WHO guidelines. ARHR, 2010